Xray concept лада: LADA XRAY Sport Concept 2021: обзор, фото, новости

Содержание

Почему серийная «Лада XRAY» не похожа на концепт-кар 2012 года

Концепт был лучше! АвтоВАЗ всё испортил! Подобными комментариями несколько лет назад встретили предсерийный вариант хэтчбека «Лада XRAY». Почему серийная модель оказалась не похожа на эффектный концепт образца 2012 года и могло ли получиться иначе?

Современные модели «Лада Веста» и «Лада XRAY» вполне по праву находятся на верхних строчках хит-парада продаж в России. Создатели пошли по пути ведущих мировых производителей: связали разные модели общей дизайнерской стилистикой, под которую скоро «причешут» и «Гранту». И начинался этот процесс с концепт-каров, сначала поисковых, «общих», а потом и предсерийных.

Так что же представляют из себя эти красочные машины за традиционной стеклянной оградой и почему всё-таки стоит изучить информацию о концепте, а не включать «синдром Хатико» и страдать по «обманутым ожиданиям»?

Концепт-кар Lada XRAY, 2012 год

История современного вазовского стиля стартует в 2011 году, когда на АвтоВАЗ под начало президента Игоря Комарова пришёл титулованный британский дизайнер Стив Маттин, к тому моменту подаривший миру несколько автомобилей Volvo и Mercedes-Benz, включая легендарные модели SLR McLaren и Maybach. И уже через год, в августе 2012 года, на Московском автосалоне представили первый плод работы Маттина — Lada XRAY Concept.

Задача этой машины — продемонстрировать общую стилистику будущих моделей, о чём сам Маттин говорил в интервью. Не выкатить перспективную серийную машину, а показать, в каком ключе будут развиваться «Лады»! Ну а кроме того, концепт позволил АвтоВАЗу закрепить за собой первенство с икс-образным дизайном передка, ведь уехавший из Тольятти в Mitsubishi дизайнер примерно в то же время корпел над «апгрейдом» визуального языка японской марки в том же ключе.

Естественно, представить новые дизайнерские идеи нужно в лучшем свете, и концепт с этим прекрасно справился. Замысловатые формы, сложный рисунок светодиодной светотехники, дорогие материалы отделки салона и многое другое. Никак не хуже, чем у других. Да и создавался макет по тем же технологиям, что и концепты Honda, Subaru, Kia, Hyundai, Porsche. И делали выставочный образец те же люди — специалисты итальянской студии Vercamodel Saro.

Сотрудники компании Vercamodel Saro у концепт-кара Lada XRAY, 2014 год

Если при взгляде на концепт кажется, что это почти готовая машина, просто «принаряженная» к выставке, значит, обман удался. Конструкция здесь совсем другая. Начинается всё с пенопластовой болванки на тележке с простым каркасом. От неё, как от заготовки скульптуры, отсекают всё лишнее... нет, не скульпторы, а точные пятикоординатные станки.

Потом вырезаются внутренние полости, включая пространство салона, в котором появляются сиденья на каркасе серийных, но заново обитые поролоном и кожей, а также передняя панель и обивки из модельной пены, обтянутые «притворяющейся» пластиком плёнкой. Стёкла на поверку совсем не стёкла, а плексиглас, да и внешние кузовные панели с металлом не знакомы: они выполнены из стеклопластика. Диски в буквальном смысле «слепили из того, что было»: у обычного диска срезают лишние части, а сверху лепят новый дизайн из модельного полимера.

Интерьер концепта Lada XRAY, 2012 год

А фары-то какое загляденье! Только это и не фары вовсе, а декоративные фонарики из светодиодов и матового пластика, созданные только для того, чтобы красиво светиться, но ни в коем случае не светить. Тем, кто хотя бы время от времени заглядывал в школу, понятно, что такая конструкция по определению не способна дать правильную светотеневую границу, а просто светит равномерно во все стороны.

Имитация фар на концепте

А как оно ездит? Да примерно так же, как светят «фары». По силовому агрегату здесь тоже сплошная унификация: маломощный электромотор в компании с механической коробкой да свинцово-кислотные аккумуляторы. Всё это нужно только для того, чтобы не пришлось каждый раз таскать макет руками.

Подвески в привычном понимании вообще нет, то есть здесь отсутствуют упругие элементы. Спереди, правда, есть телескопический элемент, похожий на амортизатор, но предназначен он всего лишь для изменения клиренса, чтобы можно было и спорткар сымитировать, и кроссовер. Сзади тем же самым заведуют пластины с прорезями и болты. «Фольксвагены» да «Шкоды», говорите, нынче жёсткие? Это вы ещё на концепт-карах не ездили.

Если бы концепт Lada XRAY 2012 года предназначался к выходу в серию с неизменным дизайном, автомобиль не потерялся бы на фоне лучших образцов мирового автопрома. Но ему такой судьбы изначально не готовили, не желая даже задумываться (а тем более объявлять) о том, с какой платформой можно его «подружить», какими моторами оснастить и когда запускать. В то время АвтоВАЗ считали производителем очень простых и, соответственно, дешёвых машин с качеством комплектующих в режиме свободного плавания, и столь резкий скачок в плане класса и цены без вариантов остался бы непонятым. Машина бы воспринималась как очередные «Жигули», но в другой оболочке, и просто не разошлась бы тем тиражом, который необходим для рентабельности производства. К тому же, это был трёхдверный «зализанный» хэтчбек, что ещё больше ограничивало возможную целевую аудиторию. И что делать? Идти вверх постепенно! И начать это движение предстояло двум будущим серийным автомобилям, наделённым новой дизайнерской ДНК...

Концепт-кар Lada Vesta, 2014 год

По плану, пойти в серийное производство они должны были в сентябре 2015 года и феврале 2016 года. Но в августе 2014 года проходил очередной Московский автомобильный салон, и на нём вазовцы решили показать новые модели, ведь на 2015 год крупных выставок не планировалось. И, так как до конвейера машинам было ещё далеко, а показывать собранные по обходным технологиям полуфабрикаты себе дороже, к публике вышли предсерийные концепты Vesta и... XRAY (XRAY Concept 2, если точнее).

И тут у многих, что называется, сломался мозг: мол, как это так, два года назад показывали совсем другое. «Упрощение!» «Обман!» «Да я уже деньги накопил, чтобы тот купить!» А интервью, пресс-релизы и официальные ролики читать и смотреть, конечно же, никто не стал. Ну или про них забыли. Самое главное — название одинаковое, а что там официальные лица говорили, неважно.

Концепт-кар Lada XRAY, 2014 год

В этот раз выставлялись автомобили, изначально и предназначенные для серийного производства. «Веста» — «главное блюдо», абсолютно новая конструкция на своей собственной платформе Lada B, выросшей из прототипа ВАЗ-2116 (проект С). XRAY — ещё один «ребёнок» глобальной платформы В0, а точнее, переработка хэтчбека Sandero Stepway. Но это всё было впереди.

А под софитами выставки оказались ближайшие родственники концепта XRAY 2012 года, сделанные в той же мастерской Vercamodel по той же технологии, но по внешности практически идентичные будущим товарным экземплярам, за исключением тех же поправок: огромные диски и красивые гирлянды вместо рабочей светотехники. Именно поэтому вопросы «а где взять такую оптику?» и «почему они такие жадные, что не пустили эти фары в серию?» могут вызвать только улыбку.

В итоге, как мы знаем, обе модели успешно стартовали и хорошо продаются. И всё-таки, если бы серийному хэтчбеку подобрали другое название вместо имени XRAY, это помогло бы избежать синдрома Хатико?

Концептом Lada XRAY вазовцы показали новое лицо марки — ДРАЙВ

В переводе XRAY означает «рентгеновские лучи». Буква X в названии — это ещё и отсылка к вседорожным возможностям автомобиля, и главный элемент нового дизайна. Стив Маттин, создавший XRAY, до прихода в АвтоВАЗ трудился на Mercedes и на Volvo.

Одним из важнейших событий Международного мотор-шоу в Москве, безусловно, можно назвать презентацию концепта АвтоВАЗа. Шоу-кар Lada XRAY, созданный под руководством нового шеф-дизайнера марки Стива Маттина, призван показать, каким будет лицо отечественных автомобилей.

Концепт-кар произвёл настоящий фурор. Публика встретила кроссовер восторженно — и понятно, почему. Автомобиль выглядит весьма привлекательно. Конечно, в экстерьере множество футуристичных деталей, которые мы вряд ли когда-либо увидим на серийных машинах, но такой дизайн — прорыв для волжского производителя.

Интересно, что означает икс на передке российского автомобиля? Не иначе пресловутый Х-фактор...

Салон получился под стать внешнему облику. Потрогать его, правда, не удалось — на стенде автомобиль стоял с наглухо закрытыми дверями.

Сами тольяттинцы подтверждают: точно в таком виде автомобиль не встанет на конвейер, но серийная модель унаследует многие черты. Так, например, буква Х спереди, которую образуют фары, решётка радиатора и линии на бампере, станет самым узнаваемым элементом экстерьера новых автомобилей Lada.

Lada XRay Concept - цены - характеристики

Последние новости о Lada XRay

13.08.2014

Бу Андерссон назвал даты выхода моделей XRay и XRay Cross

Кроссовер XRay встанет на конвейер в январе 2016 года, а в апреле того же года в серию пойдет и полноприводная версия XRay Cross. Об этом рассказал журналистам президент "АвтоВАЗа" Бу Андерссон, отметив, что обе модели станут "революционными продуктами" в модельном ряду Lada.

23.07.2014

АВТОВАЗ в 2016 году начнет выпуск новых моделей Lada X-Ray и X-Ray Cross

АВТОВАЗ планирует запустить производство моделей Lada X-Ray и Lada X-Ray Cross в январе и апреле 2016 года соответственно, сообщил президент компании Бу Андерссон. По его словам, АВТОВАЗ намерен вернуть себе 20% доли рынка в России, для чего нужно запустить новые модели и улучшать существующий модельный ряд Lada. «В сентябре 2015 года мы запускаем производство Lada Vesta, в январе 2016 года – X-Ray, в апреле – X-Ray Cross», – заявил глава АВТОВАЗа, которого цитирует агентство «Финмаркет».

17.03.2014

Будущие кроссоверы Lada будут похожи на концепт XRay

Шеф-дизайнер "АвтоВАЗа" Стив Маттин поделился некоторой информацией относительно будущих моделей российского автогиганта. Все они, так или иначе, позаимствуют новый фирменный стиль, заложенный нашумевшим концептом Lada XRay.

27.01.2014

Lada Largus получит внешность в стиле концепта XRay

Стали известны первые подробности о преемниках концепта Lada XRay, наделавшего много шуму на автосалоне в Москве в 2012 году. Аналогичный стиль получит обновленный универсал Lada Largus. Правда, увидим мы его только в 2016 году.

Моторные и трансмиссионные масла для Lada Xray

Практически все производители легковых автомобилей сегодня, в своем ассортименте модели выполненные в стиле SUV. Автоваз тоже не исключение. Правда если именитые бренды в данном сегменте давно и уже выработали определенные лекала, как данный класс презентовать потребителю, для тольятинского завода такой сегмент был в новинку.

Однако, рынок, показал, что ВАЗу не стоит себя сдерживать и презентовал в далеком уже 2012 году концепт LADA XRAY Concept. Интерес новинка вызвала не только у журналистов, но и у конечных потребителей. Концепт обсуждался на форумах, в обзорах, были произведены исследования рынка все указывало, что данная модель будет востребована. В декабре 2015 года модель начала выпускаться серийно.

Дизайн разрабатывался специалиста ВАЗа а конструкция совместно со специалиста RENAULT, Такой подход позволил создать действительно симпатичный автомобиль с надежной конструкцией, адаптированной к российским реалиям. Такой подход позволил существенно унифицировать агрегаты с уже выпускаемыми моделями завода.

XRAY комплектуется двумя моделями двигателей, основное отличие моторов  объем и количество лошадиных сил.

Модель 21129 объем двигателя 1596 см3 106 лошадиных сил и модель 21179 рабочим объемом 1774 см3 122 лошадиные силы. И отличительной чертой от VESTы, является наличие импортного мотора h5M, производства компании RENAULT, объемом 1598 см3 и 110 лошадиных сил. Выбор не особо широкий, но позволяет выбрать автомобиль по желанию и уровню комплектации.

С трансмиссиями дело обстоит чуть сложнее на данный момент представлено 5 вариантов моделей..

Три из них это коробки производства компании RENAULT под индексами JR5 518, JR5 523 и Jh4 512.

Две оставшиеся это отечественная разработка: индексы 21809 механика и 21827 роботизированная коробка.

Не скроем, многие ждут эту модель на полноценном автомате и в варианте с полным приводом, однако завод не торопиться с выводом таких комплектаций на рынок. Надеемся, что в скором времени такая комплектация появиться в ассортименте.

Владельцы XRAY приобретая автомобиль, обязательно озадачиться тем, как правильно и с помощью каких материалов обслужить свою машину. Модель новая, ее эксплуатационные характеристики и надежность будет сильно зависеть если использовать при обслуживании качественные материалы для проведения ТО.

 

Немецкий производитель автомобильных масел и автохимии, компания LIQUI MOLY предлагает широкую линейку продукции для обслуживания любых марок и моделей представленных на рынке. Продукцию Автоваза компания не обошла вниманием и предлагает материалы отличного немецкого качества для проведения регламентных работ.

Моторы нового поколения с индексами 21129 и 21179  предъявляют более высокие требования к выбору смазочных материалов. Наличие в гамме двигателя концерна RENAULT с индексом h5M потребовало учитывать требования производителя двигателя. Для данного двигателя ГСМ материалы также есть в ассортименте LIQUI MOLY. Для всей гаммы двигателей производитель рекомендует масла с высокими качественными характеристиками.

Владельцам автомобилей оснащенных двигателем ВАЗ 21129 объемом 1596 см3 мы можем предложить использование универсального моторного масла Optimal Synth 5W-40. Спецификации продукта превосходят требования производителя, что позволяет эксплуатировать автомобиль с различными нагрузками. Но если владелец хочет максимальной защиты двигателя, при экстремальных нагрузках рекомендуем использовать фирменный продукт компании НС-синтетическое моторное масло Molygen New Generation 5W-40.

Тем кто приобрел более мощную версию автомобиля оснащенную двигателем 21179 рабочим объемом 1774 см3 необходимо учитывать конструктивные особенности мотора и  использовать масла вязкостью 5W-30. Оптимальным выбором из ассортимента LIQUI MOLY будет НС-синтетическое моторное масло Optimal HT Synth 5W-30.

Линейка Optimal в ассортименте LIQUI MOLY была разработана и произведена на заводе в Германии с учетом особенностей эксплуатации автомобилей в российских условиях.

Для версии автомобиля с импортным мотором компания LIQUI MOLY рекомендует использовать НС-синтетическое моторное масло Special Tec LL 5W-30. Из линейки специальных масел.

Специальные масла – масла для современных двигателей, где предъявляются специальные требования по характеристикам моторного масла со стороны автопроизводителей. В то же время двигатели автомобилей последних поколений имеют особенности технического обслуживания, например, удлиненные интервалы, электронный контроль сроков ТО и т.п., что накладывает дополнительные требования на свойства и состав моторных масел.

Для трансмиссий автомобилей XRAY требования унифицированы с модельным рядом VESTA.

Роботизированные коробки обладают определенными требованиями по специфике применения. Необходимо учитывать, что применение определённого типа масла сказывается на плавности переключения и топливной экономичности. Технологи компании LIQUI MOLY разработали специальный продукт для применения в таких трансмиссиях НС-синтетическое трансмиссионное масло Top Tec MTF 5200 75W-80.

Данный продукт, позволяет эксплуатировать автомобиль оснащенный роботизированной трансмиссией с максимальным комфортом, а пакет присадок в масле предохраняет трансмиссию от износа.

В случае оснащения механической коробкой рекомендуем использовать:  Синтетическое трансмиссионное масло Hochleistungs-Getriebeoil 75W-90 с максимальными защитными свойствами и прекрасными низкотемпературными характеристиками. Хочется заметить, что данный продукт универсален и подходит под все виды механических трансмиссий производства ВАЗ и RENAULT которыми оснащается XRAY.

Для облегчения выбора продукции компании прилагаем таблицу применения продукции LIQUI MOLY на автомобилях ВАЗ модельного ряда XRAY.

 

XRAY

 

 

двигатель

21129 1,6/16

21179  1,8/16

h5М

LIQUI MOLY (артикул продукции)

3926

9054

39001

8055

трансмиссия

(5МТ) 21807

(5АМТ) 2182

(5МТ) Jh4

(5АМТ) 2182

(5МТ) 2180

(5МТ) JR5

LIQUI MOLY (артикул продукции)

3979

20845

3979

20845

3979

3979

 

Надеемся, наши рекомендации позволят Вам сделать правильный выбор!

Кроссовер Lamborghini и концепт-кар Lada XRAY - новинки автосалона 2012

https://ria.ru/20120830/733248376.html

Кроссовер Lamborghini и концепт-кар Lada XRAY - новинки автосалона 2012

Кроссовер Lamborghini и концепт-кар Lada XRAY - новинки автосалона 2012

Кроссовер Lamborghini, бронированный Hyundai Equus и концепт-кар Lada XRAY. Смотрите на видео РИА Новости, какие еще автомобили можно увидеть на Московском международном автосалоне-2012.

2012-08-30T00:33

2012-08-30T00:33

2020-02-29T15:49

/html/head/meta[@name='og:title']/@content

/html/head/meta[@name='og:description']/@content

https://cdn22.img.ria.ru/images/sharing/article/733248376.jpg?7332476051582980569

россия

москва

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

2012

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

Новости

ru-RU

https://ria.ru/docs/about/copyright.html

https://xn--c1acbl2abdlkab1og.xn--p1ai/

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

Кроссовер Lamborghini и концепт-кар Lada XRAY - новинки автосалона 2012

Кроссовер Lamborghini, бронированный Hyundai Equus и концепт-кар Lada XRAY. Смотрите на видео РИА Новости, какие еще автомобили можно увидеть на Московском международном автосалоне-2012.

2012-08-30T00:33

true

PT2M42S

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

россия, автопром, москва, в мире, видео, эфир

00:33 30.08.2012 (обновлено: 15:49 29.02.2020)

Кроссовер Lamborghini, бронированный Hyundai Equus и концепт-кар Lada XRAY. Смотрите на видео РИА Новости, какие еще автомобили можно увидеть на Московском международном автосалоне-2012.

Концепт Lada XRAY2 оказался высоким хэтчбеком в стиле SUV — журнал За рулем

Одним из ярких событий Московского автофорума стал Concept 2 Lada XRAY. Это компактный высокий хэтчбек в стиле SUV, предназначенный для активной городской езды. Автомобиль создан в рамках сотрудничества Renault и АВТОВАЗа на платформе В0, а оригинальный дизайн Lada XRAY разработан стилистами АВТОВАЗа под руководством Стива Маттина.

DSC_0162

Concept 2 Lada XRAY уже в «базе» получит такие системы, как регулировка водительского сиденья по высоте, обогрев лобового стекла и руля, сидений и наружных зеркал. Специально разработанные эргономичные сиденья обеспечат удобство даже во время длительных поездок.

Конструкция второго концепта Lada XRAY предусматривает хорошие возможности трансформации салона: спинка сиденья переднего пассажира складывается и со сложенным задним сиденьем образует ровную поверхность; при наличии органайзера багажного отделения образуется так называемый ровный пол, обеспечивающий удобство перевозки габаритных грузов. Сохранить порядок в багажнике поможет сетка для удержания вещей, оснащенная удобными и легкими в использовании креплениями.

DSC_0178

Выдвижной ящик под сиденьем переднего пассажира, съемный ящик под полом багажника, органайзер в нише запасного колеса, пластиковые ниши за арками задних колес, подстаканники, карманы в обивках дверей, охлаждаемый перчаточный ящик — специально организованные места для хранения вещей позволят рационально использовать внутреннее пространство автомобиля.

Концепт2_3

Уже в минимальной комплектации Lada XRAY2 оснащена подушками безопасности водителя и пассажира, системами курсовой устойчивости и автоматического вызова экстренных служб (ЭРА-ГЛОНАСС).

Высокая подоконная линия, большие колеса, увеличенный клиренс (более 170 мм) подчеркивают «внедорожный» стиль городского хэтчбека — компактного снаружи и просторного внутри. Традиционно, как и все автомобили модельного ряда Lada, XRAY2 полностью адаптирован к сложным российским дорожным и климатическим условиям эксплуатации, подходит как для ежедневного использования в городе, так и для загородных дорог, выездов на природу.

Производство нового компактного хэтчбека Lada XRAY планируется начать в 2016 году на площадке АВТОВАЗа (Тольятти). На пресс-конференции руководитель проекта Олег Груненков отметил, что одним «икс-реем» АВТОВАЗ не ограничится, разрабатывается еще и кроссовер, который будет доступен как в переднеприводном, так и в полноприводном исполнении.

Концепт Lada XRAY АВТОВАЗ впервые показал на Московском автосалоне в 2012 году. Он также сегодня представлен на стенде.

DSC_0180

Концепт Lada XRAY2 оказался высоким хэтчбеком в стиле SUV

Одним из ярких событий Московского автофорума стал Concept 2 Lada XRAY. Это компактный высокий хэтчбек в стиле SUV, предназначенный для активной городской езды. Автомобиль создан в рамках сотрудничества Renault и АВТОВАЗа на платформе В0, а оригинальный дизайн Lada XRAY разработан стилистами АВТОВАЗа под руководством Стива Маттина.

Концепт Lada XRAY2 оказался высоким хэтчбеком в стиле SUV

LADA представляет XCODE на тольяттинском автосалоне

На тольяттинском автосалоне MOTOREXPO-2016 LADA представляет 6 концептуальных автомобилей, которые раскрывают потенциальные направления развития модельного ряда. Вместе с концепт-карами в экспозиции LADA участвуют модернизированные серийные модели.

Кроме того, на MOTOREXPO-2016 демонстрируется LADA Granta Sport, LADA Largus фургон и две мелкосерийных модификации LADA 4х4 - болотоход ''Марш'' и автомобиль повышенной проходимости ''Рысь''. Как и другие специальные версии LADA, эти внедорожники можно приобрести через официальную дилерскую сеть.

Одной из новинок автосалона стала перспективная система LADA Connect, которая позволит управлять системами автомобиля с помощью смартфона.

Подробная информация обо всех представленных автомобилях и фото доступны по ссылке MOTOREXPO

Тольяттинский автосалон проходит с 22 по 25 сентября в УСК ''Олимп''. Традиционно для сотрудников АВТОВАЗа организовано бесплатное посещение автосалона. С 23 по 25 сентября каждый работник, предъявив свой служебный пропуск, сможет прийти на выставку и провести с собой еще одного посетителя. Для детей до 7 лет вход свободный. Время работы выставки с 23 по 25 сентября: с 10.00 до 20.00.

Концептуальный LADA XCODE Concept

LADA XCODE Concept - автомобиль, демонстрирующий возможное развитие модельного ряда LADA и новой дизайнерской концепции, в основе которой лежит ИКС-стиль. XCODE Concept выполнен в рамках ДНК дизайна, которая уже успешно реализована в серийных автомобилях Vesta и XRAY.

Концепция автомобиля предусматривает ряд перспективных решений, в том числе применение турбомотора и полноприводной трансмиссии, а также телематической платформы LADA Connect, которая позволяет управлять системами автомобиля с помощью смартфона, а в перспективе пользоваться из автомобиля облачными сервисами.

Дополнительная информация о LADA XCODE и фото доступны по ссылке: LADA XCODE Concept

Концептуальные Cross

LADA Vesta Cross Concept Седан

Седан в роли кроссовера – концептуальное решение, уникальное не только для российского, но и для мирового автомобильного рынка. Рост спроса на кросс-версии, соединенный с традиционной российской приверженностью статусным седанам, может дать старт разработке действительно оригинального автомобиля. Седан LADA Vesta Cross Concept оснащен специальным обвесом, который защищает эмаль кузова на легком бездорожье. Концепция автомобиля предусматривает увеличенный клиренс и более крупные колеса, что повышает внедорожный потенциал седана LADA Vesta.

Дополнительная информация о LADA Vesta Cross Concept Седан и фото доступны по ссылке LADA Vesta Cross Concept Sedan.

LADA Vesta SW Cross Concept

Концептуальный универсал, показанный впервые в 2015 году. Это пример развития проекта LADA Vesta и интерпретации нового ИКС-образного стиля LADA в формате вседорожного универсала. Динамичный силуэт универсала сочетается с увеличенным клиренсом и развитым обвесом из неокрашенного пластика. Совместно со штампованными элементами ИКС-стиля на боковинах, внедорожные накладки придают автомобилю спортивный, мускулистый и пропорциональный облик. Примечательно, что на концептуальном универсале применены задние фонари, унифицированные с седаном. Запуск автомобиля в серийное производство запланирован на вторую половину 2017 года.

Дополнительная информация о LADA Vesta SW Cross Concept и фото доступны по ссылке LADA Vesta SW Cross Concept

LADA XRAY Cross Concept

От своего серийного прототипа LADA XRAY Cross Concept отличается вседорожным обвесом. Это накладки на пороги, расширители арок, накладки на бамперы. Аналогичный обвес, защищающий эмаль кузова на легком бездорожье, применяется сегодня на серийных Kalina и Largus в модификации Cross.

Дополнительная информация о LADA XRAY Cross Concept и фото доступны по ссылке LADA XRAY Cross Concept

Концептуальные Sport

LADA Vesta Sport Concept

LADA Vesta Sport Concept демонстрирует богатый потенциал седана-бестcеллера. Кузов и салон концепта выполнены в гоночном стиле. Автомобиль оснащен подвеской с гоночными настройками - при этом использован опыт участия команд LADA в соревнованиях мирового уровня, в т.ч. в Чемпионате по турингу WTCC. Напомним, что в июне 2016 года заводская команда LADA Sport Rosneft сделала победный дубль на домашнем этапе в России.

Дополнительная информация о LADA Vesta Sport Concept и фото доступны по ссылке LADA Vesta Sport Concept

LADA XRAY Sport Concept

Концептуальный автомобиль иллюстрирует возможное развитие линейки серийных LADA с форсированными моторами и гоночным стилем. Как и у концепта LADA Vesta Sport, двигатель LADA XRAY Sport Concept базируется на серийном 1,8-литровом моторе. Доработка и перенастройка двигателя могут поднять его мощность со штатных 122 л.с. до 145-150 л.с. Подвеска автомобиля была занижена и получила спортивные настройки.

Дополнительная информация о LADA XRAY Sport Concept и фото доступны по ссылке LADA XRAY Sport Concept

Концепты LADA Vesta Sport Concept и LADA XRAY Sport Concept созданы в рамках единой стратегии спорт-версий LADA - в настоящий момент выпускаются аналогично модифицированные Kalina Sport и Granta Sport.

Новые модификации серийных LADA

LADA Vesta CNG Taxi

Перспективная модификация LADA Vesta, которая позволяет использовать два вида топлива: сжатый природный газ (метан) и бензин. Работа на сжатом природном газе позволяет снизить затраты на топливо более чем в 3 раза. Это очень важно для корпоративного транспорта и таксопарков – именно поэтому LADA Vesta CNG изготовлена в варианте такси. Метан более экологичен и менее взрывоопасен, чем пропан и бензин. Кроме того, работа на природном газе увеличивает ресурс мотора.

Дополнительная информация о LADA Vesta CNG Taxi и фото доступны по ссылке LADA Vesta CNG .

LADA Vesta 1.8 Exclusive

Модификация, которая сегодня готовится к производству. Ее отличие - новый силовой агрегат (аналогичный устанавливается на LADA XRAY). 1,8-литровый мотор LADA мощностью 122 л.с. оснащен системой электронной регулировки фаз газораспределения (VVT). Для автомобиля предусмотрена как механическая коробка передач, так и автоматизированная механическая трансмиссия (АМТ) - совместная разработка LADA и немецкой фирмы ZF. АМТ откалибрована таким образом, чтобы приспосабливаться под индивидуальный стиль вождения.

Новая модификация Exclusive дополнена такими опциями как кожаная обивка сидений, руля, подсветка салона в ногах пассажира и водителя, хромированные молдинги на дверях и др.

Дополнительная информация о LADA Vesta Exclusive и фото доступны по ссылке LADA Vesta Exclusive

Общая информация по LADA Vesta - по ссылке LADA Vesta

LADA Connect

LADA Connect – перспективная телематическая платформа, которая позволит управлять системами автомобиля с помощью смартфона. Это уникальная опция для автомобилей доступного и среднего ценовых сегментов. На тольяттинском автосалоне можно ознакомиться с настройками системы и протестировать некоторые из функций LADA Connect: подачу звукового и светового сигнала, получение данных о геолокации, температуре воздуха в салоне и снаружи автомобиля, проверить, закрыты ли двери и багажник автомобиля. Первые LADA Vesta и LADA XRAY с функцией Connect планируется выпустить в 2017 году.

Подробная информация о LADA Connect доступна по ссылке LADA Connect .На тольяттинском автосалоне MOTOREXPO-2016 LADA представляет 6 концептуальных автомобилей, которые раскрывают потенциальные направления развития модельного ряда. Вместе с концепт-карами в экспозиции LADA участвуют модернизированные серийные модели.

Произошла ошибка при настройке пользовательского файла cookie

Этот сайт использует файлы cookie для повышения производительности. Если ваш браузер не принимает файлы cookie, вы не можете просматривать этот сайт.


Настройка вашего браузера для приема файлов cookie

Существует множество причин, по которым cookie не может быть установлен правильно. Ниже приведены наиболее частые причины:

  • В вашем браузере отключены файлы cookie. Вам необходимо сбросить настройки своего браузера, чтобы он принимал файлы cookie, или чтобы спросить, хотите ли вы принимать файлы cookie.
  • Ваш браузер спрашивает вас, хотите ли вы принимать файлы cookie, и вы отказались. Чтобы принять файлы cookie с этого сайта, нажмите кнопку «Назад» и примите файлы cookie.
  • Ваш браузер не поддерживает файлы cookie. Если вы подозреваете это, попробуйте другой браузер.
  • Дата на вашем компьютере в прошлом. Если часы вашего компьютера показывают дату до 1 января 1970 г., браузер автоматически забудет файл cookie. Чтобы исправить это, установите правильное время и дату на своем компьютере.
  • Вы установили приложение, которое отслеживает или блокирует установку файлов cookie. Вы должны отключить приложение при входе в систему или проконсультироваться с вашим системным администратором.

Почему этому сайту требуются файлы cookie?

Этот сайт использует файлы cookie для повышения производительности, запоминая, что вы вошли в систему, когда переходите со страницы на страницу. Чтобы предоставить доступ без файлов cookie потребует, чтобы сайт создавал новый сеанс для каждой посещаемой страницы, что замедляет работу системы до неприемлемого уровня.


Что сохраняется в файле cookie?

Этот сайт не хранит ничего, кроме автоматически сгенерированного идентификатора сеанса в cookie; никакая другая информация не фиксируется.

Как правило, в файле cookie может храниться только информация, которую вы предоставляете, или выбор, который вы делаете при посещении веб-сайта. Например, сайт не может определить ваше имя электронной почты, пока вы не введете его. Разрешение веб-сайту создавать файлы cookie не дает этому или любому другому сайту доступа к остальной части вашего компьютера, и только сайт, который создал файл cookie, может его прочитать.

Произошла ошибка при настройке пользовательского файла cookie

Этот сайт использует файлы cookie для повышения производительности. Если ваш браузер не принимает файлы cookie, вы не можете просматривать этот сайт.


Настройка вашего браузера для приема файлов cookie

Существует множество причин, по которым cookie не может быть установлен правильно. Ниже приведены наиболее частые причины:

  • В вашем браузере отключены файлы cookie. Вам необходимо сбросить настройки своего браузера, чтобы он принимал файлы cookie, или чтобы спросить, хотите ли вы принимать файлы cookie.
  • Ваш браузер спрашивает вас, хотите ли вы принимать файлы cookie, и вы отказались. Чтобы принять файлы cookie с этого сайта, нажмите кнопку «Назад» и примите файлы cookie.
  • Ваш браузер не поддерживает файлы cookie. Если вы подозреваете это, попробуйте другой браузер.
  • Дата на вашем компьютере в прошлом. Если часы вашего компьютера показывают дату до 1 января 1970 г., браузер автоматически забудет файл cookie. Чтобы исправить это, установите правильное время и дату на своем компьютере.
  • Вы установили приложение, которое отслеживает или блокирует установку файлов cookie. Вы должны отключить приложение при входе в систему или проконсультироваться с вашим системным администратором.

Почему этому сайту требуются файлы cookie?

Этот сайт использует файлы cookie для повышения производительности, запоминая, что вы вошли в систему, когда переходите со страницы на страницу. Чтобы предоставить доступ без файлов cookie потребует, чтобы сайт создавал новый сеанс для каждой посещаемой страницы, что замедляет работу системы до неприемлемого уровня.


Что сохраняется в файле cookie?

Этот сайт не хранит ничего, кроме автоматически сгенерированного идентификатора сеанса в cookie; никакая другая информация не фиксируется.

Как правило, в файле cookie может храниться только информация, которую вы предоставляете, или выбор, который вы делаете при посещении веб-сайта. Например, сайт не может определить ваше имя электронной почты, пока вы не введете его. Разрешение веб-сайту создавать файлы cookie не дает этому или любому другому сайту доступа к остальной части вашего компьютера, и только сайт, который создал файл cookie, может его прочитать.

Протеазный анализ для двухфотонной кросс-корреляции и FRET-анализ, основанный исключительно на флуоресцентных белках

Реферат

GFP и красный флуоресцентный белок, DsRed, были объединены для разработки анализа протеазы, который позволяет не только проводить исследования резонансного переноса энергии флуоресценции (FRET), но и проводить двухцветный кросс-корреляционный анализ, метод на основе одной молекулы, который избирательно исследует одновременное движение двух разных тегов. Принцип измерения основан на обнаружении со спектральным разрешением одиночных молекул, диффундирующих в дифракционно-ограниченном лазерном фокусе и из него.Молекулы субстрата с двойной меткой разделяются на два продукта с одной меткой путем специфического расщепления в сайте расщепления протеазой между двумя фланкирующими метками, DsRed и GFP, тем самым нарушая совместные колебания в двух каналах обнаружения и завершая FRET между двумя метками. В отличие от ферментных анализов, основанных исключительно на FRET, этот метод двухцветной кросс-корреляции не ограничен определенным диапазоном расстояний между флуорофорами и является гораздо более универсальным в отношении возможной конструкции субстрата.Для упрощения измерительной установки использовалось двухфотонное возбуждение, позволяющее одновременно возбуждать обе метки одной длиной волны инфракрасного лазера. Общая концепция была экспериментально подтверждена с помощью конструкции GFP – пептид – DsRed, содержащей сайт расщепления протеазой вируса травления табака. Двухфотонное возбуждение в инфракрасном диапазоне и использование клонируемых меток делают этот анализ легко адаптируемым для внутриклеточных приложений. Более того, сочетание FRET и кросс-корреляционного анализа в подходе на основе одной молекулы обещает захватывающие перспективы для миниатюрного высокопроизводительного скрининга на основе флуоресцентной спектроскопии.

Белковые взаимодействия стали важной темой в биохимии в постгеномную эпоху. С ростом числа новых белков, выявленных в результате геномных исследований, и последующей задачей определения их функций, были разработаны новые технологии для приложений in vivo и для высокопроизводительного скрининга. Конфокальное обнаружение в сочетании с анализом редких или единичных флуоресцентных молекул в водной среде (1–3) в настоящее время считается одним из наиболее многообещающих инструментов из-за его высокой чувствительности, относительной неинвазивности и низкого расхода образцов.На основе флуоресцентных репортерных молекул, обычно белков или нуклеиновых кислот, помеченных синтетическими красителями, эти инструменты позволяют разнообразным биологическим процессам стать доступными для чувствительных биофизических методов. Флуоресцентная корреляционная спектроскопия (FCS) (1, 4, 5), один из наиболее известных из этих методов, анализирует мельчайшие спонтанные флуктуации эмиссионного поведения малых молекулярных ансамблей, которые отражают лежащую в основе межмолекулярную и внутримолекулярную динамику. Поскольку FCS наблюдает флуоресцентные молекулы в наномолярном диапазоне, он может давать информацию, точно имитирующую реальные физиологические условия, о различных процессах, таких как реакции ассоциации и диссоциации, перенос, ферментативные обороты биохимических субстратов и внутримолекулярные (например,g., структурная) динамика в широком диапазоне разрешения в пространстве и времени.

Один из наиболее многообещающих спектроскопических инструментов для изучения белок-белковых взаимодействий в живой клетке, резонансный перенос энергии флуоресценции (FRET), недавно был использован для разработки эффективных методов внутриклеточного связывания лигандов (6) и протеаз (7). . Здесь о клеточных процессах можно судить по спектральным изменениям сигнала излучения из-за зависящей от расстояния передачи энергии от возбужденного донорного красителя к длинноволновому акцептору.Благодаря своей высокой специфичности FRET оказался полезным для исследования молекулярных взаимодействий и конформационных изменений даже в масштабе одной молекулы (2, 8). Однако, поскольку FRET требует пространственных расстояний между донорными и акцепторными красителями, как правило, 20–60 Å (8), это накладывает фундаментальные ограничения на изучение молекулярных взаимодействий или образования или разрыва связей (т.е. для индикации активности фермента).

Анализ двухцветной флуоресцентной кросс-корреляционной спектроскопии (dcFCCS) (9) позволяет обойти это ограничение, регистрируя сопутствующие флуктуации сигнала из конфокального объема детектирования в двух спектрально различных каналах излучения и позволяет зондировать чрезвычайно низкие концентрации флуорофора с временным разрешением до десятков наносекунд.В режиме одной молекулы совпадающие флуктуации сигнала в обоих каналах обнаружения однозначно указывают на наличие прочных химических или физических связей между флуорофорами. Ранее это успешно использовалось для количественного изучения эндонуклеолитического расщепления двунитевой двухцепочечной ДНК (дцДНК) в режиме реального времени (10, 11). Ограничивая параметры считывания либо амплитудами кросс-корреляции, либо измерениями совпадений, скорость анализа может быть улучшена в соответствии со стандартами высокопроизводительного скрининга, обеспечивая надежные оценки типа «да» или «нет» в течение нескольких секунд выборки (12).Кроме того, dcFCCS недавно был применен для изучения внутриклеточных явлений, таких как эндоцитоз (13).

Двухфотонное возбуждение (TPE) в сочетании с dcFCCS дает особые преимущества для внутриклеточных приложений, такие как ограничение повреждения клеток и потребления образцов путем фотообесцвечивания, аналогично аналогичным in vivo двухфотонным экспериментам FCS (14, 15). TPE возникает только в непосредственной близости от фокального пятна за счет квазиодновременного поглощения двух фотонов ближнего инфракрасного диапазона.Поскольку для вероятностей переходов между основным и возбужденным состояниями применяются разные правила выбора четности, спектры двухфотонного возбуждения могут значительно отличаться от соответствующих однофотонных спектров. Следовательно, еще одним существенным преимуществом двухфотонного возбуждения является возможность одновременного возбуждения спектрально различных красителей с одной и той же длиной волны инфракрасного излучения.

С момента введения клонируемых флуоресцентных меток, таких как GFP, наиболее привлекательными анализами, особенно с точки зрения внутриклеточной применимости, безусловно, являются те, которые могут быть полностью адаптированы к таким репортерным системам «живого цвета», поскольку их вмешательство в организм может быть сведены к минимуму.Однако до сих пор разработка полностью белкового фермента или анализа связывания с белками для возможного использования с dcFCCS или другими видами анализа одиночных молекул в живых клетках, однако, ограничивалась отсутствием подходящих пар флуоресцентных белков, которые соответствуют необходимым критериям для анализа, т. е. в значительной степени разные спектры излучения, но схожая фотостабильность. В этом исследовании мы представляем доказательство принципа того, что современная двухцветная технология FCCS в сочетании с TPE действительно может быть применена к генетически кодируемым флуоресцентным меткам для выполнения кинетического ферментного анализа на уровне отдельной молекулы.Для достижения этой цели был создан комбинированный ферментный анализ FRET / кросс-корреляции на основе GFP с красным смещением (rsGFP) (16) и DsRed (17), соединенных коротким белковым линкером длиной 32 аминокислот (см. Рис. 1 a ), содержащий целевой сайт rTEV, рекомбинантного фрагмента протеазы вируса травления табака (TEV) (18). При расщеплении протеазой отделение флуоресцентных белков от репортерной конструкции контролировали количественно с помощью двухцветной кросс-корреляции, которая позволяет различать различные концентрации ферментов в наномолярном диапазоне (см.рис.1 b ). Эффективность FRET субстрата одновременно наблюдали во время переваривания протеазой, регистрируя выход молекулярных фотонов в секунду, обеспечивая альтернативный способ мониторинга реакции расщепления. Хотя теоретически эффективность FRET, равная 100%, может серьезно затруднить кросс-корреляционный анализ, мы показываем, что эффективность передачи между 30% и 60% может быть допустимой, если должным образом скорректировать ее в анализе данных.

Рис 1.

Схематическое пояснение STEV-ST и анализа флуоресцентной протеазы.( a ) Доменная структура STEV-ST. Проиллюстрированы состав и линейное расположение STEV-ST (не в масштабе). Домены rsGFP и DsRed STEV-ST соединены с помощью белкового линкера из 32 аминокислот, содержащего последовательность узнавания протеазы из протеазы TEV . С-концевой Strep-Tag II добавляли для очистки белка. Вертикальные числа указывают положение аминокислоты в белке. ( b ) Схематическое изображение, изображающее анализ протеазы на основе STEV-ST.Расщепление пептидной линкерной области репортерной конструкции протеазой TEV прекращает как FRET, так и кросс-корреляцию из-за разделения флуоресцентных белков.

Эти многообещающие результаты, хотя и получены в контролируемой системе in vitro , ясно демонстрируют, что будущее использование этой или родственных репортерных конструкций in vivo вполне возможно. Решающее преимущество этого анализа, по сравнению с предыдущими анализами одиночных молекул на основе FRET или FCS, состоит в том, что он не полагается на утомительные стратегии флуоресцентного мечения и загрузки клеток.

Материалы и методы

Теоретическая концепция.

Подробное обсуждение теории и применения кросс-корреляционного анализа можно найти в других источниках (9, 19). Нормализованная функция корреляции флуоресценции обычно определяется следующим образом: где F i ( j ) ( t ) - сигналы флуоресценции. Для i = j уравнение. 1 определяет функцию автокорреляции для одного вида молекул в одном канале обнаружения.Если флуктуации флуоресценции разных видов флуоресценции ( i j ) одновременно регистрируются в двух каналах излучения и взаимно коррелируются, G ij или G x определяет функцию кросс-корреляции. В идеальных условиях с минимальными спектральными перекрестными помехами между красителями и в отсутствие FRET амплитуда кросс-корреляции G x (0) прямо пропорциональна относительной концентрации дважды меченых видов (т.е.е., нерасщепленный субстрат в нашем анализе протеазы). Абсолютная концентрация субстрата с двойной меткой может быть получена из соответствующих амплитуд автокорреляции в соответствии с: с V eff , являющимся эффективным объемом обнаружения. При отсутствии видов с двойной меткой G x (0) равно нулю.

Опять же, в идеализированных условиях временное затухание кросскорреляционных кривых можно оценить с помощью трехпараметрической модели для одного диффундирующего вещества (19): где τ D = r / 8D определяется как среднее поперечное время диффузии для одиночной молекулы двухкомпонентных частиц в случае двухфотонного возбуждения.Здесь r 0 и z 0 - характерные поперечный и осевой размеры элемента эффективного фокального объема V eff = (π / 2) 3/2 r z 0 . Таким образом, с известным V eff , локальная концентрация флуоресцентных молекул 〈C i может быть определена путем рассмотрения автокорреляционных амплитуд согласно 〈C i 〉 = G (0) ⋅ V .С другой стороны, размер V eff может быть определен путем калибровочных измерений с чистым красителем с хорошо известным коэффициентом диффузии.

Если двухцветный анализ сочетается с FRET между отдельными флуорофорами, необходимо изменить оценку как авто-, так и кросс-корреляционных амплитуд. В этом случае необходимо учитывать молекулярную яркость η, измеряемую в фотонах на молекулу в секунду. Для определенного красителя η обычно можно определить в стандартных измерениях FCS путем умножения соответствующей амплитуды автокорреляции, обратно пропорциональной количеству наблюдаемых молекул, на среднюю скорость счета флуоресценции (9).Если η i , F и η j , F обозначают значения яркости в присутствии FRET (в нашем анализе нерасщепленной кросс-корреляционной подложки), а η i и η j описывают значения яркости красителей, не затронутых FRET (в нашем анализе, расколотых фрагментов), амплитуды авто- и кросскорреляции изменяются на: Чтобы оценить общий эффект FRET на корреляционные амплитуды, мы введем параметры f i = η i , F / η i и f j = η j , F / η j .Относительные амплитуды при наличии и отсутствии FRET могут быть записаны как:

Автокорреляция: Кросс-корреляция: где x = C ij / C 0 - фактическая относительная доля кросс-коррелирующего (т. Е. Нерасщепленного) субстрата по отношению к исходной концентрации субстрата C 0 . Поправочный коэффициент для правильной оценки амплитуд, следовательно, является динамическим, зависящим от относительных концентраций и стадии реакции.

Можно проверить, что для многих комбинаций f i / f j , в частности, если происходит резкое тушение донора или усиление акцептора, соотношение между двумя амплитудами G x (0) с FRET и без него очень нелинейный. Следовательно, если необходимо определить абсолютные концентрации видов с двойной меткой, правильная коррекция требует экспериментального контроля как f i , так и f j .Количественное соотношение между G x, FRET (0) и абсолютной концентрацией двухцветных частиц C ij определяется по формуле:

Материалы.

Протеолитические анализы проводили с использованием протеазы rTEV [29 кДа (18)], закупленной у GIBCO / BRL, с активностью 10 единиц / мкл (1 единица соответствует 100 нг или 3,5 пмоль фермента, как определено производителем). ПЦР-амплификации выполняли с использованием системы Expand High Fidelity PCR System (Roche Applied Science, Мангейм, Германия).Для целей клонирования использовали Escherichia coli XL1-blue; экспрессию белка проводили с помощью E. coli BL21 (DE3) (Stratagene). Стреп-тактин-сефароза и олигонуклеотиды были получены от IBA (Геттинген, Германия). Наборы для ПЦР-очистки и гель-экстракции были закуплены у Qiagen (Hilden, Германия).

Плазмидные конструкции.

Для создания гибридного белка rsGFP и DsRed, связанного сайтом-мишенью rTEV (из нативной последовательности полипротеина TEV ), была использована стратегия многоступенчатого клонирования (аминокислоты 2781–2797, номер доступа Национального центра биотехнологической информации.). Кодирующую последовательность rsGFP амплифицировали из pQBI63 (Q-BIOgene, San Diego) с помощью ПЦР и клонировали в плазмиду pDsRed (CLONTECH) перед кодирующей последовательностью DsRed. Фрагмент ДНК, кодирующий линкерную область полипротеина TEV (аминокислотная последовательность, QSTLEDPDIPTTENLYFQSGTVDADPRVPVAT), вставляли в сайт рестрикции BamH I между rsGFP и DsRed. Сгенерированную конструкцию клонировали в бактериальный экспрессирующий вектор pASK-IBA3 (IBA) на 21 п.н. выше C-концевой Strep-Tag II.Полученный ген (1554 п.н.) был назван STEV-ST (S для короткой линкерной области из 32 аминокислот и -ST для Strep-Tag II).

Очистка белков.

Для экспрессии белка pSTEV-ST трансформировали в E. coli BL21 (DE3) с помощью электропорации. Жидкие культуры инокулировали 500 мкл ночной культуры, выращивали при 37 ° C до A 550 0,5 и индуцировали 0,2 мкг / мл ангидротетрациклина (IBA). Через 5 часов при 25 ° C клетки собирали при 4000 × г в течение 15 минут и ресуспендировали в 8 мл буфера W (100 мМ Tris⋅HCl, pH 8.0/150 мМ NaCl / 1 мМ MgCl 2 ). Осадок клеток лизировали с использованием французского пресса и осветляли центрифугированием при 23,420 × g в течение 45 мин. Супернатант наносили на колонку Strep-Tactin Sepharose (объем слоя 2 мл; гравитационный поток; IBA), уравновешенную в буфере W. Колонку промывали 5 мл буфера W, а слитый белок элюировали буфером W плюс 2,5. мМ дестиобиотин (IBA). Фракции (0,5 мл), содержащие как зеленую, так и красную флуоресценцию, объединяли, концентрировали с помощью концентраторов отсечки молекулярной массы Vivaspin 50 000 (Sartorius) и инкубировали при комнатной температуре в течение 48 часов, чтобы обеспечить полное созревание флуорофора.Концентрация STEV-ST определялась с использованием DsRed = 75000 / M⋅cm при 558 нм (19) и rsGFP = 42933 / M⋅cm при 490 нм (CLONTECH) вместе с анализом белка BCA и SDS / СТРАНИЦА.

Конечный продукт на 80% состоит из полностью функционального STEV-ST и его производных в результате частичной деградации или неполного созревания флуорофора, тогда как после SDS / PAGE наблюдалась неспецифическая примесь примерно 20%. Вышеуказанные измерения концентрации белка и анализ FCS (см. Ниже) показали 50% -ный избыток неспаренных (только красных) молекул DsRed и что 50% очищенного белка было функциональным STEV-ST.Из-за С-концевой аффинной метки неспаренные фрагменты белка rsGFP не очищались.

Протеолитический анализ.

Протеазные реакции проводили в объемах 15 мкл в восьмилуночных камерах (Nunc) в условиях, указанных производителем. И флуоресцентный субстрат, и протеаза были разбавлены до соответствующих концентраций непосредственно перед анализом: 10 единиц rTEV и 4,5 мкМ STEV-ST для спектрального анализа и 0,4, 0,6, 1,3 и 2.5 единиц rTEV (69, 118, 236, 437 нМ rTEV) и 110 нМ STEV-ST для измерений FCCS. Реакции проводили при комнатной температуре и инициировали добавлением rTEV. Рис. 1 a иллюстрирует состав и расположение различных компонентов STEV-ST. Реакция расщепления rTEV дает rsGFP массой 29,0 кДа и фрагмент DsRed массой 29,2 кДа из слитого белка массой 58,2 кДа.

Экспериментальная установка.

Измерения двухфотонной кросс-корреляционной спектроскопии проводились на инвертированном микроскопе Olympus (Гамбург, Германия) IX-50 (рис.2, исх. 11). Двухфотонное возбуждение достигалось с помощью перестраиваемого титаново-сапфирового лазера с импульсной синхронизацией мод и частотой 80 МГц (100 фс) (Spectra-Physics). Задняя апертура объектива (UPlanApo 60 ×, 1,2 NA, Olympus) была слегка переполнена, чтобы создать ограниченное дифракцией фокусное пятно. Размер элемента эффективного объема в этой установке составляет ≈ 0,25 фл (11). Излучаемый свет с длиной волны около 550–700 нм от DsRed и 490–550 нм от rsGFP (спектры одиночного излучения не показаны) коллимировали, разделяли дихроичным зеркалом (530 DCLP, AHF, Тюбинген, Германия) и регистрировали двумя оптическими лавинные фотодиоды с волоконной связью (SPCM-200, EG&G, Vaudreuil, PQ, Canada) после прохождения полосового фильтра D620 / 100 (AHF) в DsRed и полосового фильтра HQ525 / 50M (AHF) в канале обнаружения rsGFP.Для одноцветных калибровочных измерений эмиссионного фильтра 600DF200 (AHF) было достаточно для подавления инфракрасного возбуждающего света. Конфокальные спектры получали с помощью волоконно-связанного спектрометра (Ocean Optics, Данидин, Флорида) с использованием входной щели волокна 100 мкм. Цифровые импульсы лавинных фотодиодов обрабатывались, и время коррелировалось с помощью карты многократного τ-коррелятора ALV-5000 (ALV, Ланген, Германия).

Рис 2.

Оптическая установка в виде инвертированного микроскопа Olympus IX-50.Для освещения используется одна линия титан-сапфирового лазера с настраиваемой длиной волны. Излучаемый свет разделяется дихроичным зеркалом за коллимирующей линзой и отображается на двух разных оптических волокнах. Оба волокна могут быть альтернативно подключены к спектрометру.

Результаты

Спектральный анализ и калибровочные измерения теста под TPE.

Выбор подходящих комбинаций красителей для двухфотонной кросс-корреляционной спектроскопии был основан на квантовых выходах, спектрах двухфотонного поглощения и фотостабильности, поскольку интенсивность возбуждения не может быть настроена независимо для обоих красителей.Чтобы проверить пригодность rsGFP и DsRed для одновременного TPE, их сигналы излучения сначала были записаны в одноцветной установке с возбуждением на разных длинах волн от 800 до 1000 нм (рис. 3 a ). В оптимальных условиях возбуждения, близких к насыщению, но все же ниже уровня фотообесцвечивания, выбросы достигают максимума при возбуждении 940 нм (rsGFP) и 960 нм (DsRed). Максимальный выход фотонов составлял 20 кГц / молекулу для rsGFP и 12 кГц на молекулу для DsRed. Поскольку rsGFP использовался в качестве донора FRET в описанном анализе протеазы, условия возбуждения были настроены в пользу этого красителя.Таким образом, оптимальная длина волны для совместного возбуждения обоих флуорофоров в измерениях FRET / кросскорреляции, описанных ниже, составляла 940 нм. Максимальная интенсивность 20 мВт на этой длине волны давала достаточное возбуждение для обоих красителей.

Рис 3.

Характеристика анализа протеазы STEV-ST. ( a ) Зависимость выхода флуоресценции η от длины волны для rsGFP и DsRed при двухфотонном возбуждении. Выходы фотонов на молекулу измеряли в одноцветной установке (без хроматического расщепления луча) в условиях, близких к насыщению, но значительно ниже фотообесцвечивания.Оба флуорофора эффективно возбуждались TPE с пиковым излучением при 940 нм для rsGFP (20 кГц на молекулу) и 960 нм для DsRed (12 кГц на молекулу). Оптимальная длина волны для совместного возбуждения обоих флуорофоров составляла 940 нм с максимальной интенсивностью 20 мВт. ( b ) Протеолитические изменения в спектре излучения STEV-ST в процессе пищеварения. Спектр излучения гибридного белка под TPE при 940 нм (черная линия) соответствует ≈40% FRET. Спектр непрерывно изменяется при инициировании протеолитического переваривания с добавлением rTEV (1.7 мкМ) к субстрату STEV-ST (4,5 мкМ), как показано серыми линиями. Измерения проводились в течение 10 секунд в течение 5 минут.

Для анализа спектральных свойств субстрата гибридного белка в реальных условиях измерения TPE на длине волны 940 нм регистрировали спектр испускания во время протеолитического расщепления STEV-ST в отсутствие всех фильтров испускания с полным фокусным объемом, напрямую связанным с входная щель волоконно-оптического спектрометра (рис.3 б ). Динамику этого переваривания протеазой отслеживали как совокупное измерение в 4,5 мкМ растворе STEV-ST после добавления 10 единиц rTEV / 15 мкл (1,7 мкМ rTEV) в единичных измерениях продолжительностью 10 с в течение 5 мин. На всех стадиях реакции в спектре наблюдались два отличительных пика около 510 и 580 нм, соответствующих максимумам испускания rsGFP и DsRed соответственно. Протеолитическое расщепление STEV-ST привело к сдвигу спектра излучения и выявило FRET между rsGFP и DsRed в системе.По сравнению со спектром нерасщепленного субстрата в начале реакции rsGFP показал почти 50% -ное увеличение, тогда как флуоресценция DsRed соответственно уменьшилась. Количественный анализ спектров только слитого белка и красителей показал, что эффективность FRET для интактного субстрата составила почти 40%. На основании числа аминокислот (32 аминокислотных остатка) длина белкового линкера между флуорофорами оценивалась в диапазоне от 58 Å для α-спиральной конформации до приблизительно 100 Å для расслабленной конформации.

FCS-анализ реакции расщепления на основе одной молекулы в реальном времени

Автокорреляционный / FRET-анализ.

После того, как была продемонстрирована пригодность комбинации красителей rsGFP / DsRed для двухфотонной кросс-корреляционной спектроскопии и продемонстрирована биологическая функциональность белкового субстрата, флуоресцентный анализ протеазы на основе белка стал предметом измерений FCS в масштабе одной молекулы. В реакционной смеси, содержащей 236 нМ rTEV и 110 нМ STEV-ST, расщепление протеазы контролировали в течение 10 минут со скоростью два измерения в минуту путем записи непрерывных скоростей счета фотонов, соответствующих излучению rsGFP и DsRed, вместе с соответствующими функциями автокорреляции для оба канала обнаружения.Наблюдалось большое увеличение зеленого и уменьшение скорости счета красного, тогда как соответствующие автокорреляционные функции оставались постоянными (рис. 4). Поскольку средняя молекулярная яркость на молекулу η в любой момент времени легко определяется умножением амплитуды автокорреляции на скорость счета фотонов, FCS позволяет очень чувствительно контролировать свойства излучения в присутствии и в отсутствие FRET (20). Как показано на рис. 4, скорость испускания фотонов на одну молекулу увеличивается для rsGFP более чем на 50% с 4.6 кГц (η GFP, FRET ) в начале ферментативной реакции до 7 кГц (η GFP, noFRET ) в конце. Это увеличение соответствует примерно 35% передачи энергии в интактном субстрате, что достаточно хорошо согласуется со значением 40%, определенным из анализа спектров излучения при более высоких концентрациях субстрата и фермента.

Рис 4.

FRET в масштабе одной молекулы. Автокорреляционные функции и количество фотонов на молекулу в кГц ( вставка ) для rsGFP и DsRed определяли параллельно во время инкубации 110 нМ STEV-ST с 197 нМ rTEV.Изменения интенсивности флуоресценции донора FRET (rsGFP) и акцептора (DsRed) были обнаружены сразу после добавления фермента, тогда как значения автокорреляции G (0) и количество флуоресцентных частиц оставались постоянными. Наблюдаемое увеличение флуоресценции rsGFP соответствует примерно 35% FRET в интактном субстрате.

Оценка η DsRed была несколько более сложной из-за превышения в нашем образце неспаренных фрагментов DsRed на ≈50%.Присутствие протеолизированных фрагментов DsRed подтверждалось по 2-кратному снижению амплитуды автокорреляции в красном канале по сравнению с зеленым каналом. Следовательно, значение η DsRed, FRET не эквивалентно η DsRed, 0 в начале процесса расщепления. Если n флуоресцентных частиц с разными значениями яркости η n представлены на одной автокорреляционной кривой FCS, средняя яркость 〈η〉 определяется как 〈η〉 = ∑ n C n η / ∑ n C n η n , где C n - относительные концентрации.Таким образом, в смеси FRET-активных парных и FRET-неактивных неспаренных частиц DsRed с η DsRed, noFRET = 6,7 кГц / молекула, известная из измерений конечных точек, η DsRed, FRET = 8,1 кГц / молекула было получено из средняя скорость счета η DsRed, 0 = 7,5 кГц / молекула в момент времени 0. То, что уменьшение флуоресценции DsRed после прекращения FRET составляет всего 20%, по сравнению с увеличением на 35% для GFP, можно объяснить прямым акцептором. возбуждение и сложная фотофизическая природа DsRed (21), предполагая, что энергия рассеивается при переходе от GFP к временно нефлуоресцентному состоянию акцептора.

Замечательная согласованность амплитуд автокорреляционных функций на протяжении протеолитического расщепления показывает, что практически не было потери флуоресцентных молекул из-за адсорбции или фотодеградации. Одним из наиболее важных следствий этого постоянства является исключение значительной олигомеризации DsRed в слитом белке. Если субстрат DsRed-пептид-GFP содержал DsRed в виде димера или тетрамера, как предполагалось в предыдущих исследованиях (22), протеолитическое расщепление, скорее всего, увеличило бы количество высвобождаемых частиц GFP.Таким образом, стабильность амплитуды автокорреляции GFP указывает на полное отсутствие мультимеров среди наблюдаемых (флуоресцентных) молекул субстрата.

Кросс-корреляционный анализ при наличии FRET.

Расщепление STEV-ST приводит к диссоциации двух флуорофоров (рис. 1 b ) и, как следствие, к спаду амплитуды кросскорреляции. На рис. 5 показан график кросс-корреляционных кривых, снятых в течение 380 с для образца, содержащего 110 нМ STEV-ST и 437 нМ rTEV.Зеленую и красную флуоресценцию измеряли непрерывно, а кросс-корреляционный анализ выполняли с интервалами 40 с (низкие концентрации фермента) и 20 секунд (высокие концентрации фермента).

Рис 5.

Кривые кросскорреляции, измеренные во время реакции протеолитического расщепления. 110 нМ STEV-ST инкубировали с 437 нМ rTEV при комнатной температуре. Кривые были усреднены из двух последовательных 20-секундных измерений каждое и подогнаны по формуле. 3. В ходе реакции амплитуды G (0) постепенно уменьшались, тогда как соответствующие времена диффузии оставались постоянными, обеспечивая идентичность субстрата.

Спад амплитуд кросс-корреляции G x (0) очень напоминает уменьшение концентрации интактного субстрата C ij . Однако при наличии FRET не существует простой линейной зависимости между G x (0) и C ij . Скорее, определение абсолютных концентраций субстрата требует как амплитуд автокорреляции, так и скорости счета флуоресценции (т.е.е. параметры яркости η, как указано в Theory ). Уравнение 6 описывает величину этого эффекта, которая зависит от параметров f i = η i, F / η i и f j = η j , F / η j для сравнения эмиссионных свойств обоих флуорофоров в присутствии ( F ) и в отсутствие FRET. Из значений, определенных выше, η GFP, FRET = 4.6 кГц, η GFP, noFRET = 7 кГц, η DsRed, FRET = 8,1 кГц и η DsRed, noFRET = 6,7 кГц, мы оценили f rsGFP = 0,66 и fs ed = 1,2 для нашей системы.

На рис. 6 показано общее влияние различных теоретических случаев FRET (выраженных в терминах f DsRed и f GFP ) на относительные амплитуды кросскорреляции G x, FRET (0) / G x, без FRET (0).Выделены экспериментальные условия для анализа GFP / DsRed, описанные здесь. Можно видеть, что наличие FRET в нашем случае приводит к недооценке относительной доли субстрата, которая становится тем серьезнее, чем меньше субстрата остается. Для всех комбинаций f i / f j ниже линии 1/1 присутствие FRET обычно подчеркивает изменения в режиме высоких относительных концентраций видов с двойной меткой. Для комбинаций выше линии 1/1 относительные изменения в режиме низких концентраций кросс-коррелирующих частиц более выражены.Для амплитуд автокорреляции также может наблюдаться небольшой эффект, вызванный FRET, как показано на вставке к рис. 6. Однако для комбинации f rsGFP = 0,66 и f DsRed = 1,2, как вычислено. для нашего анализа не ожидается никаких значительных изменений (менее 5% для rsGFP, менее 1% для DsRed). Эффект слишком мал, чтобы быть видимым за пределами шума на корреляционных функциях на рис. 4, что объясняет их кажущееся постоянство.

Рис 6.

Моделирование относительных амплитуд G x, FRET (0) / G x, NoFRET (0) для различных концентраций x дважды меченого FRET-субстрата во время протеолитического переваривания. В начале реакции x = 1. Относительная амплитуда взаимной корреляции, определяющая влияние FRET на анализ данных FCS, изменяется во времени дайджеста и зависит от индивидуальных соотношений f = η без изменений / η расщепляет для обоих флуорофоров соответственно.Из наших измерений FRET мы получили f GFP = 0,66 и f DsRed = 1,2 для STEV-ST (▪). ( Вставка ) Влияние FRET на амплитуды автокорреляции, предполагая то же самое f i .

Для количественного определения ферментативного расщепления реакции расщепления STEV-ST проводили при концентрациях rTEV 69, 118, 236 и 437 нМ и 110 нМ STEV-ST, что на 3 порядка ниже K M = 69 мкМ предложено Parks et al. (18). G x (0) значения получали со скоростью 2–3 измерения в минуту в течение 6–10 минут реакции. Абсолютные концентрации субстрата в заданное время (рис. 7) определяли в соответствии с уравнениями. 2–6. Из-за полного перекрытия объемов обнаружения и минимальных спектральных перекрестных помех менее 10% (данные не показаны) экспериментальная ошибка определялась исключительно неопределенностью конкретной маркировки. По оценкам, это было менее 5% на основе меченных GFP, FRET-активных молекул субстрата.

Рис 7.

Кинетика реакции протеолитического расщепления при различных концентрациях фермента. Протеолитические реакции проводили при комнатной температуре с использованием 110 нМ STEV-ST. Концентрации ферментов в диапазоне от 69 до 473 нМ были легко различимы, особенно по их начальным скоростям реакции (см. Вставку ). Начальные скорости реакции были получены из точек данных в первые 60–180 с реакции путем линейной регрессии после корректировки амплитуд FRET, как описано.

Концентрации фермента, отличающиеся менее чем в 2 раза, можно легко отличить по ходу реакции и более количественно от начальных скоростей реакции (рис. 7, , вставка ). Для отрицательного контроля (без фермента) в течение 10-минутного измерения не было обнаружено уменьшения сигнала кросс-корреляции. Как видно на фиг. 5, амплитуда кросс-корреляционной функции не снижалась ниже ≈20% от ее начального значения даже при более длительном времени реакции, указывая на то, что остаточное количество кросс-корреляционного субстрата не подвергалось влиянию процесса расщепления.Поскольку сайт-мишень протеазы фланкирован двумя довольно большими глобулярными доменами, сайт расщепления мог быть не полностью доступен в этой остаточной фракции.

Резюме и заключение

Протеазный анализ, подходящий для двухцветной двухфотонной флуоресцентной кросс-корреляционной спектроскопии в масштабе одной молекулы, был разработан исключительно на основе генетически кодируемых меток. Этот специально разработанный субстрат слитого белка, STEV-ST, состоит из rsGFP-пептид-DsRed с сайтом расщепления протеазы TEV в пептидной области и демонстрирует ослабление перекрестной корреляции, а также FRET между флуорофорами во время ферментативного расщепления при мониторинге в в реальном времени.Существует огромная потребность в альтернативных и универсально применимых системах для измерения внутриклеточных молекулярных взаимодействий и определения кинетики реакции белков и ферментов, особенно в отношении выяснения функции белков и приложений для высокопроизводительного скрининга.

Комбинация TPE, FCS / FCCS и FRET в сочетании с анализом белковых флуоресцентных субстратов для мониторинга протеолитической деградации приводит к чрезвычайно чувствительному и селективному методу отслеживания динамических процессов в физиологических условиях в реальном времени. поддается адаптации для сотовых приложений.Ограничения, накладываемые альтернативными методами, такими как стандартный FRET, в отношении расстояний между флуорофорами, могут быть преодолены путем использования двухцветной кросс-корреляции, которая учитывает динамическое сопутствующее движение молекул красителя независимо от их размера и близости. . По сравнению с предыдущей работой с использованием двухфотонных измерений FCCS с синтетическими красителями (11), комбинация флуоресцентных белков, DsRed и rsGFP, по-видимому, хорошо подходит для одновременного возбуждения с помощью TPE.DsRed, несмотря на его медленное созревание и тенденцию к агрегации в качестве нативного белка, хорошо работал в слитой конструкции, будучи связанным с фрагментами белка как на его N-, так и на C-конце. В заключение, это исследование представляет собой доказательство принципа распространения приложений двухфотонной кросс-корреляционной спектроскопии на белковые репортерные молекулы с перспективой применения этой технологии для диагностики, скрининга и биологических исследований клеток.

Благодарности

Мы благодарим Майкла Янца, Эльке Хаустейн и Петру Диттрих за полезные обсуждения; Карин Биркенфельд за помощь в подготовке проб; и Салли Ким за критическую корректуру.Благодарим за финансовую поддержку Министерства образования и исследований Германии (гранты Biofuture 0311845 и 16SV1257) и Evotec BioSystems AG (Гамбург, Германия). Структурные данные для рис. 1 b были получены от Research Collaboratory for Structural Bioinformatics (www.rcsb.org/pdb/; IDs: 1G7K; 1EMF) и визуализированы с помощью расмола (www.umass.edu/microbio/rasmol/ ).

Сокращения

  • rsGFP, GFP с красным смещением

  • TPE, двухфотонное возбуждение

  • FRET, резонансный перенос энергии флуоресценции

  • dcFCCS, двухцветная кросс-корреляционная спектроскопия флуоресценции

  • дцДНК, двухцепочечная ДНК

  • FCS, флуоресцентная корреляционная спектроскопия

  • TEV, вирус травления табака

  • Поступила 31.03.02.
  • Принято 22 июля 2002 г.
  • Copyright © 2002, Национальная академия наук

Сравнение кристаллографии, ЯМР и ЭМ

Сравнение кристаллографии, ЯМР и EM

Структурная биология включает в себя методы и принципы молекулярной биологии, биохимии и биофизики как средства выяснения молекулярной структуры и динамики биологически значимых молекул.Недавний прогресс в приборостроении подтвердил новый импульс в структурной биологии, поскольку сложные биологические молекулы теперь можно анализировать с беспрецедентной легкостью и эффективностью. Трехмерная структура белков и белковых комплексов позволяет лучше понять законы жизнедеятельности и механизмы заболеваний, что позволяет рационально разрабатывать новые диагностические и терапевтические средства. Существует три основных метода исследования структурной биологии: дифракция рентгеновских лучей на монокристаллах (SC-XRD), ядерный магнитный резонанс (ЯМР) и криоэлектронная микроскопия (Cryo-EM).Однако универсального метода не существует, поскольку все три из них обладают уникальными преимуществами, а также ограничениями.

Рис.1. Три основных метода исследования структурной биологии. Согласно статистике PDB (https://www.rcsb.org/), с помощью SC-XRD было разрешено более 120 000 белковых структур, что составляет почти 90% от общего числа. И есть около 12000 белковых структур, полученных с помощью ЯМР. Хотя общее количество белковых структур, разрешенных с помощью Cryo-EM, несопоставимо с таковым при использовании первых двух методов, в последние годы наблюдается взрывной рост структур при использовании этого метода.

1. Монокристалл Дифракция рентгеновских лучей

Рентгеновская кристаллография использует рентгеновские лучи для определения положения и расположения атомов в кристалле. Самый классический метод рентгеновской кристаллографии - это дифракция рентгеновских лучей на монокристаллах, при которой атомы кристаллов заставляют падающий рентгеновский луч производить рассеянные лучи. Когда рассеянные лучи попадают на детектор, эти лучи создают спекл-дифракционную картину. По мере постепенного поворота кристалла можно измерить угол и интенсивность этих дифрагированных лучей, а затем создать трехмерное изображение электронной плотности внутри кристалла.На основе этой электронной плотности можно определить среднее положение атомов в кристалле, химические связи, кристаллические барьеры и различную информацию. Для монокристалла с достаточной чистотой, однородностью и регулярностью данные дифракции рентгеновских лучей могут определять средний угол химической связи и длину с точностью до нескольких десятых градуса и нескольких тысячных долей ангстрема соответственно.

Рис.2. Физико-математические основы рентгеновской кристаллографии для решения структуры

Метод дифракции рентгеновских лучей на монокристаллах был предложен и разработан в 1912 году, и он стал наиболее важным и полезным инструментом для определения структуры белка, поскольку структура белка миоглобина была впервые определена в 1958 году.В настоящее время в банке данных белков (https://www.rcsb.org/) депонировано более 140000 белковых структур, почти 90% из которых разрешены с помощью метода дифракции рентгеновских лучей на монокристаллах, что свидетельствует о его преимуществах при изучении структуры биологические кристаллы макромолекул.

Процесс дифракции рентгеновских лучей на монокристалле можно условно разделить на четыре этапа. Первым шагом является получение высококачественных монокристаллов целевого белка, что называется кристаллизацией белка.Когда раствор солюбилизированного белка достигает перенасыщения, он способствует агрегации и зародышеобразованию белка. В конечном итоге отдельные белковые молекулы образуют повторяющуюся серию элементарных ячеек, принимая единообразную ориентацию. Квалифицированные кристаллы должны быть достаточного размера (обычно более 50 мкм по всем измерениям) и качества (правильная структура, без трещин или двойников). Получение монокристаллов высокого качества является ограничивающим шагом для определения структуры с помощью этого метода.

После получения монокристалла требуется дифракционный эксперимент.Кристалл иммобилизуют в интенсивном рентгеновском луче, создавая дифракционную картину, которая регистрируется как данные дифракции (угол и интенсивность дифрагированных рентгеновских лучей). По мере того как кристалл постепенно поворачивается, предыдущие отражения исчезают и появляются новые. Интенсивность дифракции в каждом пятне регистрируется с каждого направления кристалла.

Впоследствии данные дифракции, полученные из дифракционной картины, комбинируются с различными методами структурного анализа и подбора данных для анализа распределения электронной плотности в трехмерном пространстве внутри элементарной ячейки.

На последнем этапе на основе карты электронной плотности может быть создана и уточнена модель расположения атомов в кристалле.

Рис.3. Метод рентгеновской дифракции на монокристаллах

Этот метод может обеспечить высокое атомное разрешение и не ограничен молекулярной массой образца. Он подходит для водорастворимых белков, мембранных белков, а также макромолекулярных комплексов. При правильном манипулировании он становится мощным инструментом для доставки надежных структурных данных биологических макромолекул и определения положения и структуры активного центра, а также помогает понять, как белок распознает и связывает молекулы лиганда на атомном уровне.

Однако метод дифракции рентгеновских лучей на монокристаллах также имеет ряд недостатков. Во-первых, образец должен быть кристаллизованным, но кристаллизация биологических макромолекул с большой молекулярной массой может быть затруднена, в частности, мембранные белки сложнее кристаллизовать из-за их большого размера и плохой солюбилизации. Во-вторых, должен быть получен организованный монокристалл, обеспечивающий соответствующую дифракцию. Наконец, полученная трехмерная структура биологического образца представляет собой только статическую форму исследуемой молекулы (одна из многих возможных), а не динамическая.

2. Ядерный магнитный резонанс (ЯМР)

Второй метод - ядерный магнитный резонанс (ЯМР). Ядра - это заряженные, быстро вращающиеся частицы, похожие на внешние электроны. Гиромагнитные отношения разных атомных ядер различны и поэтому имеют разные резонансные частоты. Движение ядра не изолировано - оно взаимодействует с окружающими атомами как внутри-, так и межмолекулярно. Следовательно, с помощью спектроскопии ядерного магнитного резонанса можно получить структурную информацию о данной молекуле.Взяв в качестве примера белок, его вторичная структура, такая как α-спираль, β-лист, виток, круг и завиток, отражают различное расположение атомов основной цепи молекул белка в трехмерном пространстве. Расстояние между атомными ядрами в различных вторичных доменах, взаимодействие между ядрами и динамические характеристики полипептидных сегментов - все это напрямую отражает трехмерную структуру белков. Все эти ядерные особенности вносят вклад в спектроскопическое поведение анализируемого образца, обеспечивая, таким образом, характерные сигналы ЯМР.Интерпретация этих сигналов компьютерными методами приводит к расшифровке трехмерной структуры.

Рис.4. Ядерный спин

С момента первого наблюдения сигналов ЯМР в конденсированном состоянии в 1946 году технология ЯМР бурно развивалась на протяжении более 70 лет, и ее применение распространилось из области физики, такой как определение магнитного момента ядра, на химию, медицину, материаловедение, науки о жизни и многие другие. Примечательно, что в 1980-х годах технология ЯМР была творчески применена в структурном анализе белка, что способствовало применению ЯМР в биологической области.Хотя объем данных о трехмерной структуре белков, полученных с помощью технологии ЯМР, несравним с данными по дифракции рентгеновских лучей на монокристаллах, уникальные преимущества технологии ЯМР широко заметны: ЯМР может предоставить информацию на кинетической основе, таким образом, внутреннее перемещение белков в различных временных масштабах и их механизм связывания с лигандами могут быть решены.

ЯМР-эксперимент состоит из четырех основных этапов: подготовка образца, сбор данных, спектральная обработка и структурный анализ.ЯМР-анализ выполняется на водных образцах белка с высокой чистотой, высокой стабильностью и высокой концентрацией. Объем образца от 300 до 600 мкл с диапазоном концентраций 0,1–3 мМ. Использование стабильных изотопов 15N, 13C и 2H для мечения белков может эффективно увеличить интенсивность сигнала и разрешение. Селективное мечение определенных аминокислот или химических групп белков может значительно уменьшить перекрытие сигналов. Для получения информации о белке используются многомерные ЯМР-эксперименты.Затем выполняется спектральная обработка для определения атомов белка, соответствующих каждому спектральному пику на разных ЯМР-спектрах. Наконец, ряд пространственно структурированной информации, такой как константы связи NOE и J, используется для расчета пространственной структуры с использованием методов дистанционной геометрической или молекулярной динамики.

Рис.5. Технология ядерного магнитного резонанса

Наиболее важной особенностью метода ЯМР является то, что трехмерную структуру макромолекул в естественном состоянии можно измерить непосредственно в растворе, а ЯМР может предоставить уникальную информацию о динамике и межмолекулярных взаимодействиях.Разрешение макромолекулярной трехмерной структуры может достигать субнанометра.

Однако спектр ЯМР биомолекул с большой молекулярной массой очень сложен и труден для интерпретации, что ограничивает применение ЯМР при анализе больших биомолекул. Кроме того, этот метод требует относительно большого количества чистых образцов (порядка нескольких мг) для достижения приемлемого уровня отношения сигнал / шум.

3. Криоэлектронная микроскопия (Cryo-EM)

Третий подход - это метод криоэлектронной микроскопии (Крио-ЭМ), который включает три различных метода: анализ отдельных частиц, электронную томографию и электронную кристаллографию.Существенный механизм Cryo-EM - рассеяние электронов. Основной принцип описывается следующим образом. Перед анализом образцы готовят путем криоконсервации. Когерентные электроны используются в качестве источника света для измерения образца. После того, как электронный луч проходит через образец и ближайший слой льда, система линз преобразует рассеянный сигнал в увеличенное изображение, записанное на детекторе. И обработка сигнала выполняется для получения трехмерной структуры образца.

Электронная микроскопия технология трехмерной реконструкции была впервые открыта в 1968 году. Трехмерная структура хвоста фага Т4 была реконструирована с помощью электронных микрофотографий. И тогда были предложены общая концепция и методы трехмерной реконструкции электронной микроскопии. Для уменьшения радиационных повреждений в 1974 году была создана криогенная электронная микроскопия. После более чем 30-летнего развития Cryo-EM стала мощным инструментом для изучения структуры биологических макромолекул.В последние годы технология Cryo-EM достигла революционного прогресса, особенно в анализе отдельных частиц. С 2013 года, благодаря огромным достижениям в области детектирования электронов и обработки изображений, крио-ЭМ анализ одиночных частиц развивался настолько быстро, что разрешение Cryo-EM теперь сравнимо с разрешением дифракции рентгеновских лучей на монокристаллах. В настоящее время Крио-ЭМ становится мощным инструментом для определения структуры биологических макромолекул с высоким разрешением.

Перед использованием Cryo-EM для наблюдения за образцом можно использовать отрицательное окрашивание EM для быстрого скрининга гомогенного образца.Метод анализа одиночных частиц Cryo-EM начинается с стеклования образца. Во время этого процесса раствор белка мгновенно охлаждается, поэтому молекулы воды не кристаллизуются, образуя аморфное твердое вещество. Затем замороженный образец проверяется, и данные собираются в системе. В этот период можно сделать серию двумерных изображений. Затем на основе большого количества полученных двумерных изображений выполняется выравнивание и классификация частиц. В конце данные обрабатываются программным обеспечением реконструкции для создания трехмерной структурной модели.

Рис.6. Метод анализа одиночных частиц Cryo-EM

По сравнению с дифракцией рентгеновских лучей на монокристалле, обработка образца быстрым замораживанием сохраняет его состояние, близкое к естественному. Более того, этот метод требует лишь небольшого количества образца (около 0,1 мг), более прост в отношении чистоты образца и не требует кристаллизации белка.

Главный недостаток этого метода заключается в том, что частицы обнаруживаются в неизвестной ориентации.Высокий уровень шума из-за использования ограниченных доз электронов для минимизации радиационного повреждения, особенно при высоком разрешении, имеет тенденцию усложнять определение этих ориентаций, и это особенно важно для более мелких частиц. Следовательно, определение структуры биологических макромолекул с помощью Cryo-EM было ограничено большими комплексами или моделями с низким разрешением в течение последних нескольких лет.

Рис.7. Криоэлектронная микроскопия

4. Резюме

Таким образом, каждая технология имеет свои преимущества в определенных приложениях, так что в одних случаях один метод может использоваться широко, а в других - редко.Таким образом, понимание характера анализа является ключевым при выборе метода. Неправильный выбор метода не только приведет к скомпрометированным результатам, он также может вызвать значительные задержки проекта и привести к финансовым потерям. Для получения дополнительной информации, пожалуйста, см. Таблицу 1.

9036 X-907 • Хорошо проработанный


• Высокое разрешение
• Широкий диапазон молекулярной массы
• Простота построения моделей
Преимущества Недостатки Объекты Разрешение
• Трудно для кристаллизации
• Трудно для дифракции
• Предпочтительна твердая структура
• Статическая структура в кристаллическом состоянии
• Кристаллизуемые образцы
• Растворимые белки, мембранные белки, рибосомы, ДНК / РНК и белковые комплексы
Высокая
ЯМР • Высокое разрешение
• Трехмерная структура в растворе
• Подходит для динамического исследования
• Необходимость в высокой чистоте пробы
• Сложно для пробоподготовки
• Сложно для компьютерного моделирования
• ММ ниже 40–50 кДа
• Водорастворимые образцы
Высокая
Cryo-EM • Простая подготовка образца
• Структура в исходном состоянии
• Небольшой размер образца
• Относительно низкое разрешение
• Применимо только к образцам с высокой молекулярной массой
• Сильно зависит от методов ЭМ
• Дорогостоящее оборудование ЭМ
•> 150 кДа
• Вирионы, мембранные белки, большие белки, рибосомы, комплексные соединения
Относительно низкий (

Таблица 1 Сравнение рентгеновской кристаллографии, ЯМР и крио-ЭМ

Ссылки

  1. Ван, Х.W .; Ван, В. Как криоэлектронная микроскопия и рентгеновская кристаллография дополняют друг друга. Protein Science 2017, 26 (1): 32-39.
  2. Ранкин, Н .; и др. . Появление метаболомики протонного ядерного магнитного резонанса в сердечно-сосудистой системе с клинической точки зрения. Атеросклероз 2014, 237 (1): 287-300.
  3. Каррони М., Сайбил Р. Крио-электронная микроскопия для определения структуры макромолекулярных комплексов. Методы 2016, 95: 78-85.
  4. Каллавей, Э. Революция не будет кристаллизоваться: новый метод пронизывает структурную биологию. Nature News 2015 525 (7568): 172.